missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KREMEN1 Partial ORF (NP_114434, 310 a.a. - 391 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00083999-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16190597

  • 5540.00 NOK / 25µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq]

Sequence: INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
Specifications

Specifications

NP_114434
Liquid
83999
KREMEN1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ31863/KREMEM1/KREMEN/KRM1
KREMEN1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.76kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE
RUO
KREMEN1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers