missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human KLHDC3 Partial ORF (NP_476502, 1 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00116138-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16191507

  • 5540.00 NOK / 25µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene contains six repeated kelch motifs that are structurally similar to recombination activating gene 2 (RAG2), a protein involved in the activation of the V(D)J recombination. In mouse, this gene is found to express specifically in testis. Its expression in pachytene spermatocytes is localized to cytoplasma and meiotic chromatin, which suggests that this gene may be involved in meiotic recombination. [provided by RefSeq]

Sequence: MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGAC
Specifications

Specifications

NP_476502
Liquid
116138
KLHDC3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PEAS/RP1-20C7.3/dJ20C7.3/hPEAS
KLHDC3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.96kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGAC
RUO
KLHDC3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers