Learn More
Abnova™ Human KLHDC3 Partial ORF (NP_476502, 1 a.a. - 102 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00116138-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene contains six repeated kelch motifs that are structurally similar to recombination activating gene 2 (RAG2), a protein involved in the activation of the V(D)J recombination. In mouse, this gene is found to express specifically in testis. Its expression in pachytene spermatocytes is localized to cytoplasma and meiotic chromatin, which suggests that this gene may be involved in meiotic recombination. [provided by RefSeq]
Sequence: MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGACSpecifications
NP_476502 | |
Liquid | |
116138 | |
KLHDC3 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
PEAS/RP1-20C7.3/dJ20C7.3/hPEAS | |
KLHDC3 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.96kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MLRWTVHLEGGPRRVNHAAVAVGHRVYSFGGYCSGEDYETLRQIDVHIFNAVSLRWTKLPPVKSAIRGQAPVVPYMRYGHSTVLIDDTVLLWGGRNDTEGAC | |
RUO | |
KLHDC3 | |
Wheat Germ (in vitro) | |
GST |