missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human Kir2Ds5 Full-Length Orf (Aai60061.1, 1 A.A.-304 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
Brand: Abnova™ H00003810-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVT
Specifications
| AAI60061.1 | |
| Liquid | |
| 3810 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CD158G/NKAT9 | |
| KIR2DS5 |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| KIR2DS5 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| MSLMVISMACVAFFLLQGAWPHEGFRRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGTFNHTLRLIGEHIDGVSKGNFSIGRMTQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNRTFQADFPLDPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNSSNSWPSPTEPSSETGNPRHLHVLIGTSVVKLPFTILLFFLLHRWCSNKKNASVMDQGPAGNRTVNREDSDEQDHQEVSYA | |
| RUO | |
| KIR2DS5 | |
| GST |
For Research Use Only