missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ITGA11 Partial ORF (NP_001004439, 793 a.a. - 893 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00022801-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136602

  • 5420.23 NOK / 25µg

Estimated Shipment: 25-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein contains an I domain, is expressed in muscle tissue, dimerizes with beta 1 integrin in vitro, and appears to bind collagen in this form. Therefore, the protein may be involved in attaching muscle tissue to the extracellular matrix. Alternative transcriptional splice variants have been found for this gene, but their biological validity is not determined. [provided by RefSeq]

Sequence: LDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVC
Specifications

Specifications

NP_001004439
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.85kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVC
RUO
ITGA11
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
22801
ITGA11 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HsT18964
ITGA11
Yes
Videos
SDS
Documents
Certificates