missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ID2 Partial ORF (NP_002157, 1 a.a. - 67 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003398-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16196541

  • 5540.00 NOK / 25µg
Estimated Shipment: 23-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq]

Sequence: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQH
Specifications

Specifications

NP_002157
Liquid
3398
ID2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GIG8/ID2A/ID2H/MGC26389/bHLHb26
ID2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.11kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQH
RUO
ID2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers