missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ICT1 Partial ORF (NP_001536, 107 a.a. - 206 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003396-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16139764

  • 3602.46 NOK / 10µg

Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells. [provided by RefSeq]

Sequence: TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
Specifications

Specifications

NP_001536
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
RUO
ICT1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3396
ICT1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DS-1
ICT1
Yes
Videos
SDS
Documents
Certificates