missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HRASLS Partial ORF (NP_065119, 55 a.a. - 138 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00057110-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138996

  • 4130.00 NOK / 10µg
Estimated Shipment: 11-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: SAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANR
Specifications

Specifications

NP_065119
Liquid
57110
HRASLS (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
A-C1/H-REV107/HRASLS1/HSD28
HRASLS
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.98kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANR
RUO
HRASLS
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers