missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human hCG_2023776 Full-length ORF (XP_208373.5, 1 a.a. - 317 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00402562-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16190654

  • 4115.00 NOK / 10µg
Estimated Shipment: 19-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MSKSESPKEPKQLRKLFIGGLSFETTNESLRSHFEQWGTLMDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVESKRAVSREDSQRPGAHLTVKKIFVGGIKEDTKEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHICEVRKALSKQEMASTSSSQRGQSGSGNFSGGRGGGFSGNDNFGHGGNFSGRGGFGGSRGAGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFRPMKGGNFGGRSSGPYGGGGNTLQNQGGYGSSSSSSSYGSGRRF
Specifications

Specifications

XP_208373.5
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
60.3kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC402562
hCG_2023776
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
402562
hCG_2023776 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSKSESPKEPKQLRKLFIGGLSFETTNESLRSHFEQWGTLMDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVESKRAVSREDSQRPGAHLTVKKIFVGGIKEDTKEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHICEVRKALSKQEMASTSSSQRGQSGSGNFSGGRGGGFSGNDNFGHGGNFSGRGGFGGSRGAGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFRPMKGGNFGGRSSGPYGGGGNTLQNQGGYGSSSSSSSYGSGRRF
RUO
hCG_2023776
Wheat Germ (in vitro)
GST
Liquid
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers