missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GRIN2C Full-length ORF (AAH59384.1, 1 a.a. - 171 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002905-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16195761

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of the key receptor subunit NMDAR1 (GRIN1) and 1 or more of the 4 NMDAR2 subunits: NMDAR2A (GRIN2A), NMDAR2B (GRIN2B), NMDAR2C (GRIN2C), and NMDAR2D (GRIN2D).

Sequence: MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG
Specifications

Specifications

AAH59384.1
Liquid
2905
GRIN2C (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG
RUO
GRIN2C
Wheat Germ (in vitro)
GST
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
44kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NMDAR2C/NR2C
GRIN2C
Yes
wheat germ expression system
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers