Learn More
Abnova™ Human GLS2 Partial ORF (NP_037399.2, 543 a.a. - 602 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00027165-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well. At least one transcribed pseudogene has been found for this gene. [provided by RefSeq]
Sequence: KVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMVSpecifications
NP_037399.2 | |
Liquid | |
27165 | |
GLS2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
GA/GLS/LGA/MGC71567/hLGA | |
GLS2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
32.34kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
KVNPFAKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTLSETQAEAAAEALSKENLESMV | |
RUO | |
GLS2 | |
Wheat Germ (in vitro) | |
GST |