missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GFR alpha-1 (aa 293-339) Control Fragment Recombinant Protein

Product Code. 30202815
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202815

Brand: Invitrogen™ RP100423

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glial cell line-derived neurotrophic factor (GDNF) is a potent survival factor for central and peripheral neurons and is essential for the development of kidneys and the enteric nerves system. Physiological responses to GDNF require the presence of a novel glycosylphosphadidylinositol linked protein GDNFRalpha, which is a cell surface receptor for GDNF. The cDNAs encoding GDNFRalpha from human, rat, chicken and mouse have been cloned recently. GDNFRalpha was also termed Ret ligand 1 (RETL1) or TGF-beta-related neurotrophic factor receptor 1 (TrnR1) and nominated as GFR-a-1 recently. GFR-a-1 binds GDNF specifically and mediates activation of the Ret protein tyrosine kinase (PTK). Thus, GDNF, GFR-a and the Ret PTK form a complex to transduce GDNF signal and to mediate GDNF function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P56159
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2674
Name Human GFR alpha-1 (aa 293-339) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU042498; DKFZp313E1012; DKFZp686J0156; FLJ10561; FLJ31546; GDNF family receptor alpha 1; GDNF family receptor alpha-1; GDNF receptor alpha; GDNF receptor alpha-1; GDNFR; GDNFRA; GDNFR-alpha; GDNFR-alpha-1; gfr alpha 1; GFR alpha-1; GFRA1; GFR-alpha-1; glial cell line derived neurotrophic factor family receptor alpha 1; Glial cell line-derived neurotrophic factor receptor alpha; GPI-linked anchor protein; MGC23045; PI-linked cell-surface accessory protein; RET ligand 1; RET1L; RETL1; TGF-beta-related neurotrophic factor receptor 1; TRNR1
Common Name GFR alpha-1
Gene Symbol GFRA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.