missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GAMT Partial ORF (NP_000147.1, 138 a.a. - 235 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00002593-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in this gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]
Sequence: PLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKSpecifications
| NP_000147.1 | |
| Liquid | |
| 2593 | |
| GAMT (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PIG2/TP53I2 | |
| GAMT | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.52kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTK | |
| RUO | |
| GAMT | |
| Wheat Germ (in vitro) | |
| GST |