missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FSHB Partial ORF (NP_000501.1, 19 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002488-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16128344

  • 4115.00 NOK / 10µg
Estimated Shipment: 07-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Specifications

Specifications

NP_000501.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.95kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
RUO
FSHB
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
2488
FSHB (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FSHB
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers