missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FSHB Partial ORF (NP_000501.1, 19 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002488-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138344

  • 6270.00 NOK / 25µg
Estimated Shipment: 01-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit. This gene encodes the beta subunit of follicle-stimulating hormone. In conjunction with luteinizing hormone, follicle-stimulating hormone induces egg and sperm production. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Sequence: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Specifications

Specifications

NP_000501.1
Liquid
2488
FSHB (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FSHB
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.95kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
RUO
FSHB
Yes
wheat germ expression system
Videos
SDS
Documents
Certificates
Special Offers

Special Offers