missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FMN2 Partial ORF (AAH14364.2, 144 a.a. - 243 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00056776-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142273

  • 3602.46 NOK / 10µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Formin homology (FH) domain proteins (e.g., FMN; MIM 136535) play a role in cytoskeletal organization and/or establishment of cell polarity.[supplied by OMIM]

Sequence: DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT
Specifications

Specifications

AAH14364.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DQEAEENSLTETHKCFLETTAYFFMKPKLGEKEVSPNAFFSIWHEFSSDFKDFWKKENKLLLQERVKEAEEVCRQKKGKSLYKIKPRHDSGIKAKISMKT
RUO
FMN2
Yes
wheat germ expression system
Liquid
56776
FMN2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FMN2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates