missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FAM107B Full-length ORF (ENSP00000367731, 1 a.a. - 131 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human FAM107B Full-length ORF (ENSP00000367731, 1 a.a. - 131 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16115403
Price: 4115.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00083641-P01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16115403

4115.00 NOK / 10µg

Estimated Shipment: 28-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES

Specifications

Accession Number	ENSP00000367731
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	42kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	C10orf45/FLJ45505/MGC11034/MGC90261
Gene Symbol	FAM107B
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	83641
Name	FAM107B (Human) Recombinant Protein (P01)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES
Regulatory Status	RUO
Common Name	FAM107B
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Product Suggestions

Abnova™ Human FAM107B Full-length ORF (ENSP00000367731, 1 a.a. - 131 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers