missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human F8 Partial ORF (NP_000123, 213 a.a. - 312 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00002157-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137894

  • 3602.46 NOK / 10µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Beschreibung

Beschreibung

This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder. [provided by RefSeq]

Sequence: KFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITF
Spezifikation

Spezifikation

NP_000123
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITF
RUO
F8
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
2157
F8 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AHF/DXS1253E/F8B/F8C/FVIII/HEMA
F8
Yes
Videos
Sicherheitsdatenblatt (SDS)
missing translation for 'documents'
Produktzertifizierungen