missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ERMAP Partial ORF (NP_001017922, 376 a.a. - 475 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00114625-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141397

  • 3602.46 NOK / 10µg

Estimated Shipment: 13-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
Specifications

Specifications

NP_001017922
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
NKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
RUO
ERMAP
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
114625
ERMAP (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC118810/MGC118811/MGC118812/MGC118813/PRO2801/RD/SC
ERMAP
Yes
Videos
SDS
Documents
Certificates