missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human EFHD1 Partial ORF (NP_079478.1, 168 a.a. - 238 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00080303-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134913

  • 3602.46 NOK / 10µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

EFHD1 is an EF-hand domain-containing protein that displays increased expression during neuronal differentiation (Tominaga and Tomooka, 2002 [PubMed 12270117]).[supplied by OMIM]

Sequence: GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
Specifications

Specifications

NP_079478.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.44kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GLMALAKLSEIDVALEGVKGAKNFFEAKVQALSSASKFEAELKAEQDERKREEEERRLRQAAFQKLKANFN
RUO
EFHD1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
80303
EFHD1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DKFZp781H0842/FLJ13612/MST133/MSTP133/PP3051
EFHD1
Yes
Videos
SDS
Documents
Certificates