missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EEF1D Partial ORF (NP_115754, 1 a.a. - 91 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001936-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit functions as guanine nucleotide exchange factor. It is reported that this subunit interacts with HIV-1 Tat, and thus it represses the translation of host-cell, but not HIV-1, mRNAs. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq]
Sequence: MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRSSpecifications
| NP_115754 | |
| Liquid | |
| 1936 | |
| EEF1D (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EF-1D/EF1D/FLJ20897/FP1047 | |
| EEF1D | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.75kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MRSGKASCTLETVWEDKHKYEEAERRFYEHEATQAAASAQQLPAEGPAMNGPGQDDPEDADEAEAPDGGSRRDPRKSQDSRKPLQKKRKRS | |
| RUO | |
| EEF1D | |
| Wheat Germ (in vitro) | |
| GST |