missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DIO1 Partial ORF (NP_000783.2, 35 a.a. - 125 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001733-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137214

  • 4130.00 NOK / 10µg
Estimated Shipment: 25-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is a thiol-requiring propylthiouracil-sensitive oxidoreductase. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). It also degrades both hormones by inner ring deiodination (IRD). Alternative splicing results in multiple transcript variants encoding different isoforms. Some, but not all, isoforms contain a selenocysteine (Sec) residue encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Additional transcript variants have been described but are not supported by experimental evidence. [provided by RefSeq]

Sequence: DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT
Specifications

Specifications

NP_000783.2
Liquid
1733
DIO1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
5DI/MGC130050/MGC130051/TXDI1
DIO1
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.75kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT
RUO
DIO1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers