missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human DAZAP2 Partial ORF (NP_055579, 93 a.a. - 168 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009802-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121296

  • 6245.00 NOK / 25µg
Estimated Shipment: 19-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a proline-rich protein which interacts with the deleted in azoospermia (DAZ) and the deleted in azoospermia-like gene through the DAZ-like repeats. This protein also interacts with the transforming growth factor-beta signaling molecule SARA (Smad anchor for receptor activation), eukaryotic initiation factor 4G, and an E3 ubiquitinase that regulates its stability in splicing factor containing nuclear speckles. The encoded protein may function in various biological and pathological processes including spermatogenesis, cell signaling and transcription regulation, formation of stress granules during translation arrest, RNA splicing, and pathogenesis of multiple myeloma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
Specifications

Specifications

NP_055579
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.1kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
RUO
DAZAP2
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
9802
DAZAP2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0058/MGC14319/MGC766/PRTB
DAZAP2
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers