missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRKL Partial ORF (NP_005198, 204 a.a. - 303 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001399-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123521

  • 4115.00 NOK / 10µg
Estimated Shipment: 07-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic

Sequence: AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
Specifications

Specifications

NP_005198
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
AHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPDENE
RUO
CRKL
Recombinant
wheat germ expression system
Antibody Production, ELISA, Protein Array, Western Blot
1399
CRKL (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CRKL
Wheat Germ (in vitro)
GST
Liquid
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers