missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CRIM1 Partial ORF (NP_057525, 36 a.a. - 145 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051232-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136746

  • 3602.46 NOK / 10µg

Estimated Shipment: 07-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Motor neurons are among the earliest neurons to appear after the commencement of cell patterning and the beginning of cell differentiation. Differentiation occurs in a ventral-to-dorsal gradient and is mediated, at least in part, by the concentration of ventrally expressed Sonic hedgehog protein (SHH; MIM 600725). Dorsally expressed factors, such as members of the bone morphogenic protein (e.g., BMP4; MIM 112262) and transforming growth factor-beta (e.g., TGFB1; MIM 190180) families, can repress the induction of these neurons. CRIM1 may interact with growth factors implicated in motor neuron differentiation and survival (Kolle et al., 2000 [PubMed 10642437]).[supplied by OMIM]

Sequence: VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
Specifications

Specifications

NP_057525
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VCLPCDESKCEEPRNCPGSIVQGVCGCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLLGFKPCNENLIAGCNIINGKCECNTI
RUO
CRIM1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51232
CRIM1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC138194/S52
CRIM1
Yes
Videos
SDS
Documents
Certificates