Learn More
Abnova™ Human CREB3L4 Partial ORF (NP_570968.1, 324 a.a. - 395 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00148327-Q02.10ug
Additional Details : Weight : 0.00010kg
Description
cAMP response element-binding (CREB) proteins are a family of mammalian transcription activators. For further background information on CREB proteins, see CREB1 (MIM 123810).[supplied by OMIM]
Sequence: SEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEMSpecifications
NP_570968.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.66kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
SEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPPGAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM | |
RUO | |
CREB3L4 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
148327 | |
CREB3L4 (Human) Recombinant Protein (Q02) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
AIBZIP/ATCE1/CREB3/CREB4/JAL/hJAL | |
CREB3L4 | |
Recombinant | |
wheat germ expression system |