missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204129

Invitrogen™ Human CPS1 Control Fragment Recombinant Protein

Product Code. 30204129
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204129

Brand: Invitrogen™ RP102361

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82760 (PA5-82760. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mitochondrial enzyme encoded by this gene catalyzes synthesis of carbamoyl phosphate from ammonia and bicarbonate. This reaction is the first committed step of the urea cycle, which is important in the removal of excess urea from cells. The encoded protein may also represent a core mitochondrial nucleoid protein. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. Mutations in this gene have been associated with carbamoyl phosphate synthetase deficiency, susceptibility to persistent pulmonary hypertension, and susceptibility to venoocclusive disease after bone marrow transplantation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31327
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1373
Name Human CPS1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4732433M03Rik; carbamoyl-phosphate synthase (ammonia); carbamoyl-phosphate synthase [ammonia], mitochondrial; carbamoyl-phosphate synthase 1; carbamoyl-phosphate synthase 1, mitochondrial; carbamoyl-phosphate synthetase 1; carbamoyl-phosphate synthetase 1, mitochondrial; carbamoylphosphate synthetase I; carbamoyl-phosphate synthetase I; carbamyl phosphate synthetase I; carboamyl-phosphate synthetase 1; cps; CPS1; CPSase I; CPSASE1; CPSI; D1Ucla3; PHN
Common Name CPS1
Gene Symbol CPS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FKIPQKGILIGIQQSFRPRFLGVAEQLHNEGFKLFATEATSDWLNANNVPANPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.