missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CPNE3 Partial ORF (NP_003900.1, 164 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008895-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16189585

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands. [provided by RefSeq]

Sequence: EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP
Specifications

Specifications

NP_003900.1
Liquid
8895
CPNE3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CPN3/KIAA0636/PRO1071
CPNE3
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.65kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP
RUO
CPNE3
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers