missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CNTFR Partial ORF (NP_671693, 47 a.a. - 158 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001271-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136504

  • 3602.46 NOK / 10µg

Estimated Shipment: 26-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq]

Sequence: GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
Specifications

Specifications

NP_671693
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.06kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
RUO
CNTFR
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
1271
CNTFR (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC1774
CNTFR
Yes
Videos
SDS
Documents
Certificates