missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CNOT8 Partial ORF (NP_004770.4, 201 a.a. - 292 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00009337-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120406

  • 4115.00 NOK / 10µg
Estimated Shipment: 24-04-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Specifications

Specifications

NP_004770.4
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.86kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
SCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
RUO
CNOT8
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
9337
CNOT8 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAF1/CALIF/POP2/hCAF1
CNOT8
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers