missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLDN8 Partial ORF (NP_955360, 29 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00009073-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
Claudins, such as CLDN8, are components of epithelial cell tight junctions. Tight junctions regulate movement of solutes and ions through the paracellular space and prevent mixing of proteins and lipids in the outer leaflet of the apical and basolateral plasma membrane domains (Acharya et al., 2004).[supplied by OMIM]
Sequence: QWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARSpecifications
| NP_955360 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.57kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAAR | |
| RUO | |
| CLDN8 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 9073 | |
| CLDN8 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CLDN8 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |