missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLDN7 Partial ORF (NP_001298, 31 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00001366-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]
Sequence: QMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRSpecifications
| NP_001298 | |
| Liquid | |
| 1366 | |
| CLDN7 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CEPTRL2/CPETRL2/Hs.84359/claudin-1 | |
| CLDN7 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.35kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| QMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATR | |
| RUO | |
| CLDN7 | |
| Wheat Germ (in vitro) | |
| GST |