missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CHAF1B Partial ORF (AAH21218, 201 a.a. - 300 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00008208-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16138305

  • 3602.46 NOK / 10µg

Estimated Shipment: 29-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. The protein encoded by this gene corresponds to the p60 subunit and is required for chromatin assembly after replication. The encoded protein is differentially phosphorylated in a cell cycle-dependent manner. In addition, it is normally found in the nucleus except during mitosis, when it is released into the cytoplasm. This protein is a member of the WD-repeat HIR1 family and may also be involved in DNA repair. [provided by RefSeq]

Sequence: QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL
Specifications

Specifications

AAH21218
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.63kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
QKKRVAFNVSKMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVYFEL
RUO
CHAF1B
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
8208
CHAF1B (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CAF-1/CAF-IP60/CAF1/CAF1A/CAF1P60/MPHOSPH7/MPP7
CHAF1B
Yes
Videos
SDS
Documents
Certificates