Learn More
Abnova™ Human CENTD2 Partial ORF (AAH56401, 101 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00116985-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activity. The encoded protein associates with the Golgi, and the ARF-GAP activity mediates changes in the Golgi and the formation of filopodia. It is thought to regulate the cell-specific trafficking of a receptor protein involved in apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: DFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTLSpecifications
AAH56401 | |
Liquid | |
116985 | |
CENTD2 (Human) Recombinant Protein (Q01) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CENTD2/KIAA0782 | |
ARAP1 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.63kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
DFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL | |
RUO | |
ARAP1 | |
Wheat Germ (in vitro) | |
GST |