missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CECR1 Partial ORF (NP_059120.2, 402 a.a. - 511 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00051816-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137356

  • 3602.46 NOK / 10µg

Estimated Shipment: 29-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a member of a subfamily of the adenosine deaminase protein family. The encoded protein may act as a growth factor and have adenosine deaminase activity. It may be responsible for some of the phenotypic features associated with cat eye syndrome. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: DIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
Specifications

Specifications

NP_059120.2
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DIPIEVCPISNQVLKLVSDLRNHPVATLMATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGGMKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKKRWDKFIADVATK
RUO
CECR1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
51816
CECR1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADGF/IDGFL
CECR1
Yes
Videos
SDS
Documents
Certificates