missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDKAL1 Full-length ORF (AAH64145.1, 1 a.a. - 97 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00054901-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16120883

  • 6245.00 NOK / 25µg

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE
Specifications

Specifications

AAH64145.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.4kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ20342/FLJ46705/MGC75469
CDKAL1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
54901
CDKAL1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE
RUO
CDKAL1
Wheat Germ (in vitro)
GST
Liquid
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers