missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CDC42EP4 Partial ORF (NP_036253, 163 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023580-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The product of this gene is a member of the CDC42-binding protein family. Members of this family interact with Rho family GTPases and regulate the organization of the actin cytoskeleton. This protein has been shown to bind both CDC42 and TC10 GTPases in a GTP-dependent manner. When overexpressed in fibroblasts, this protein was able to induce pseudopodia formation, which suggested a role in inducing actin filament assembly and cell shape control. [provided by RefSeq]
Sequence: VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIMSpecifications
| NP_036253 | |
| Liquid | |
| 23580 | |
| CDC42EP4 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BORG4/CEP4/KAIA1777/MGC17125/MGC3740 | |
| CDC42EP4 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.67kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| VPRRNGAAGPHSPDPLLDEQAFGDLTDLPVVPKATYGLKHAESIMSFHIDLGPSMLGDVLSIM | |
| RUO | |
| CDC42EP4 | |
| Wheat Germ (in vitro) | |
| GST |