missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198294

Invitrogen™ Human Carbonic Anhydrase VIII (aa 189-279) Control Fragment Recombinant Protein

Product Code. 30198294
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
30198294 100 μL 100µL
1 options
This item is not returnable. View return policy

Product Code. 30198294

Brand: Invitrogen™ RP93924

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82894 (PA5-82894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was initially named CA-related protein because of sequence similarity to other known carbonic anhydrase genes. However, the gene product lacks carbonic anhydrase activity (i.e., the reversible hydration of carbon dioxide). The gene product continues to carry a carbonic anhydrase designation based on clear sequence identity to other members of the carbonic anhydrase gene family. The absence of CA8 gene transcription in the cerebellum of the lurcher mutant in mice with a neurologic defect suggests an important role for this acatalytic form.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P35219
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 767
Name Human Carbonic Anhydrase VIII (aa 189-279) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW546993; Ca8; Cals; Cals1; CAMRQ3; Car8; carbonate dehydratase; carbonic anhydrase 8; carbonic anhydrase VIII; carbonic anhydrase-like sequence; carbonic anhydrase-like sequence 1; carbonic anhydrase-related protein; CA-related protein; CARP; CA-RP; CARP VIII; CA-RP VIII; CA-VIII; hypothetical protein LOC550233; LOW QUALITY PROTEIN: carbonic anhydrase-related protein; MGC120502; MGC99509; wdl; zgc:110118
Common Name Carbonic Anhydrase VIII
Gene Symbol Ca8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.