missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Carbonic Anhydrase I (aa 12-150) Control Fragment Recombinant Protein

Product Code. 30198165
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
30198165 100 μL 100µL
1 options
This item is not returnable. View return policy

Product Code. 30198165

Brand: Invitrogen™ RP102412

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82254 (PA5-82254. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA1 is closely linked to CA2 and CA3 genes on chromosome 8, and it encodes a cytosolic protein which is found at the highest level in erythrocytes. Variants of this gene have been described in some populations. Multiple alternatively spliced variants, encoding the same protein, have been identified. Transcript variants of CA1 utilizing alternative polyA_sites have been described in literature.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00915
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 759
Name Human Carbonic Anhydrase I (aa 12-150) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW555628; CA I; CA1; ca1 {ECO:0000250; CAB; CA-I; CA-I {ECO:0000250; Car1; Car-1; Carbonate dehydratase I; carbonate dehydratase I {ECO:0000250; carbonic anhydrase 1; carbonic anhydrase 1 {ECO:0000250; Carbonic anhydrase B; carbonic anhydrase I; carbonic anhydrase I {ECO:0000250; epididymis secretory protein Li 11; HEL-S-11; UniProtKB:P00915}
Common Name Carbonic Anhydrase I
Gene Symbol CA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.