missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human C6orf225 Full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00619208-P02.25ug
Additional Details : Weight : 0.00010kg
Beschreibung
Sequence: MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPKSpezifikation
| NP_001028736.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 35.2kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| DKFZp586F0922 | |
| C6orf225 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 619208 | |
| C6orf225 (Human) Recombinant Protein (P02) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK | |
| RUO | |
| C6orf225 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |