missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human C6orf225 Full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) Recombinant Protein with GST-tag at N-terminal

Name: Abnova&trade; Human C6orf225 Full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) Recombinant Protein with GST-tag at N-terminal
Brand: Abnova&trade;
SKU: 16130814
Price: 4115.00 EUR

Used for AP, Array, ELISA, WB-Re

Brand: Abnova™ H00619208-P02.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16130814

4115.00 NOK / 10µg

Estimated Shipment: 28-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK

Specifications

Accession Number	NP_001028736.1
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	35.2kDa
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	DKFZp586F0922
Gene Symbol	C6orf225
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	619208
Name	C6orf225 (Human) Recombinant Protein (P02)
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue
Immunogen	MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK
Regulatory Status	RUO
Common Name	C6orf225
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Product Suggestions

Abnova™ Human C6orf225 Full-length ORF (NP_001028736.1, 1 a.a. - 80 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Specifications

Product Suggestions

Documents

Special Offers