missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BOK Partial ORF (AAH17214, 95 a.a. - 212 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000666-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains all four BCL-2 like domains (BH1, 2, 3 and 4) and is a pro-apoptotic BCL-2 protein identified in the ovary. [provided by RefSeq]
Sequence: SLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPERSpecifications
| AAH17214 | |
| Liquid | |
| 666 | |
| BOK (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| BCL2L9/BOKL/MGC4631 | |
| BOK | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 38.61kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFVLLPER | |
| RUO | |
| BOK | |
| Wheat Germ (in vitro) | |
| GST |