missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human BMPR2 (aa 730-854) Control Fragment Recombinant Protein

Product Code. 30201909
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201909

Brand: Invitrogen™ RP106213

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

BMPR2 is a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs that are involved in endochondral bone formation and embryogenesis. The loss of interaction and lack of phosphorylation of TCTEL1 by BMPR2 may contribute to the pathogenesis of primary pulmonary hypertension (PPH) and BMPR2 also plays an essential role in human T-cell differentiation. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of two different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kDa and type II receptors of about 70-80 kDa. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in BMPR2 have been associated with primary pulmonary hypertension, both familial and fenfluramine-associated, and with pulmonary venoocclusive disease.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13873
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 659
Name Human BMPR2 (aa 730-854) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610024H22Rik; AL117858; AW546137; BB189135; BMP type II receptor; BMP type-2 receptor; BMP-2; BMPR2; BMPR-2; BMPR3; BMPRII; Bmpr-II; BMR2; bone morphogenetic protein receptor type 2; bone morphogenetic protein receptor type II; Bone morphogenetic protein receptor type-2; bone morphogenetic protein receptor, type II (serine/threonine kinase); bone morphogenic protein receptor, type II (serine/threonine kinase); BRK-3; Gm20272; POVD1; PPH1; T-ALK; type II activin receptor-like kinase; type II receptor for bone morphogenetic protein-4
Common Name BMPR2
Gene Symbol Bmpr2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.