Learn More
Abnova™ Human B3GNT3 Partial ORF (NP_055071, 135 a.a. - 208 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010331-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq]
Sequence: KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNSpecifications
NP_055071 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.88kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN | |
RUO | |
B3GNT3 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
10331 | |
B3GNT3 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
B3GAL-T8/B3GN-T3/B3GNT-3/HP10328/TMEM3/beta3Gn-T3 | |
B3GNT3 | |
Recombinant | |
wheat germ expression system |