missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human AVPR1A Partial ORF (NP_000697, 1 a.a. - 52 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00000552-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1B, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosphatidylinositol-calcium second messenger system. The receptor mediates cell contraction and proliferation, platelet aggregation, release of coagulation factor and glycogenolysis. [provided by RefSeq]
Sequence: MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAKSpecifications
| NP_000697 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.46kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MRLSAGPDAGPSGNSSPWWPLATGAGNTSREAEALGEGNGPPRDVRNEELAK | |
| RUO | |
| AVPR1A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 552 | |
| AVPR1A (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AVPR1 | |
| AVPR1A | |
| Recombinant | |
| wheat germ expression system |