missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208360

Invitrogen™ Human ATP6V0A4 (aa 663-740) Control Fragment Recombinant Protein

Product Code. 30208360
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
30208360 100 μL 100µL
1 options
This item is not returnable. View return policy

Product Code. 30208360

Brand: Invitrogen™ RP91135

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82613 (PA5-82613. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', and d. This gene is one of four genes in man and mouse that encode different isoforms of the a subunit. Alternatively spliced transcript variants encoding the same protein have been described. Mutations in this gene are associated with renal tubular acidosis associated with preserved hearing. [provided by RefSeq, Jul 2008]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9HBG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 50617
Name Human ATP6V0A4 (aa 663-740) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a4; Atp6n1b; ATP6N2; Atp6v0a4; ATPase H+ transporting V0 subunit a4; ATPase, H+ transporting, lysosomal (vacuolar proton pump) noncatalytic accessory protein 1 B; ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 1 B; ATPase, H+ transporting, lysosomal (vacuolar proton pump) non-catalytic accessory protein 2 (38 kD); ATPase, H+ transporting, lysosomal V0 subunit A4; H(+)-transporting two-sector ATPase, noncatalytic accessory protein 1 B; RDRTA2; RTA1C; RTADR; STV1; tcag7.346; vacuol; vacuolar proton pump 116 kDa accessory subunit; vacuolar proton pump, subunit 2; vacuolar proton translocating ATPase 100 kDa a4 subunit; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 4; Vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform; V-ATPase 116 kDa; V-ATPase 116 kDa isoform a4; V-ATPase alpha 4; VPH1; VPP2; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a isoform 4
Common Name ATP6V0A4
Gene Symbol ATP6V0A4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.