missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ATP6V0A2 Partial ORF (NP_036595, 198 a.a. - 304 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00023545-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
The protein encoded by this gene is a subunit of the vacuolar ATPase (v-ATPase), an heteromultimeric enzyme that is present in intracellular vesicles and in the plasma membrane of specialized cells, and which is essential for the acidification of diverse cellular components. V-ATPase is comprised of a membrane peripheral V(1) domain for ATP hydrolysis, and an integral membrane V(0) domain for proton translocation. The subunit encoded by this gene is a component of the V(0) domain. Mutations in this gene are a cause of both cutis laxa type II and wrinkly skin syndrome. [provided by RefSeq]
Sequence: GYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKKSpecifications
| NP_036595 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 37.51kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GYTIVSYAELDESLEDPETGEVIKWYVFLISFWGEQIGHKVKKICDCYHCHVYPYPNTAEERREIQEGLNTRIQDLYTVLHKTEDYLRQVLCKAAESVYSRVIQVKK | |
| RUO | |
| ATP6V0A2 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 23545 | |
| ATP6V0A2 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ARCL/ATP6N1D/ATP6a2/J6B7/Stv1/TJ6/TJ6M/TJ6s/Vph1/WSS/a2 | |
| ATP6V0A2 | |
| Recombinant | |
| wheat germ expression system |