missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ASCC2 Partial ORF (NP_115580, 672 a.a. - 757 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00084164-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16140657

  • 6270.00 NOK / 25µg
Estimated Shipment: 11-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS
Specifications

Specifications

NP_115580
Liquid
84164
ASCC2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ASC1p100
ASCC2
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.2kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS
RUO
ASCC2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers