missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARPC5L Partial ORF (NP_112240, 1 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00081873-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16125283

  • 6245.00 NOK / 25µg
Estimated Shipment: 17-07-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSL
Specifications

Specifications

NP_112240
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSL
RUO
ARPC5L
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
81873
ARPC5L (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARC16-2/MGC3038
ARPC5L
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers