missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARMET Partial ORF (NP_006001.2, 116 a.a. - 185 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00007873-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16128045

  • 6245.00 NOK / 25µg

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is now identified as the initiation codon. [provided by RefSeq]

Sequence: DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Specifications

Specifications

NP_006001.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.44kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
RUO
ARMET
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
7873
ARMET (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARP/MANF/MGC142148/MGC142150
ARMET
Recombinant
wheat germ expression system
Recommendations

Recommendations

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers