missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARMC8 Full-length ORF (NP_054873.2, 1 a.a. - 385 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00025852-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137822

  • 3655.00 NOK / 10µg
Estimated Shipment: 23-01-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTSPVTPEELLYTDATVIPHLMALLSRSRYTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMTLVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST
Specifications

Specifications

NP_054873.2
Liquid
25852
ARMC8 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HSPC056/MGC10058/MGC4880/S863-2
ARMC8
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
69.4kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ARMC8
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers